PTM Viewer PTM Viewer

AT3G05930.1

Arabidopsis thaliana [ath]

germin-like protein 8

No PTMs currently found

PLAZA: AT3G05930
Gene Family: HOM05D000052
Other Names: GLP8

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 219

MATSMIPIFVTFMLVAAHMALADTNMLQDFCVADLSNGLKVNGYPCKDPAKVTPEDFYFIGLATAAATANSSMGSAVTGANVEKVPGLNTLGVSISRIDYAPGGLNPPHLHPRASEAIFVLEGRLFVGFLTTTGKLISKHVNKGDVFVFPKALLHFQQNPNKAPASVLAAFDSQLPGTQVVGPSLFGSNPPIPDDLLAKAFGAAAPEIQKIKGKFPPKK

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR006045 60 209
Molecule Processing
Show Type From To
Signal Peptide 1 22
Sites
Show Type Position
Active Site 109
Active Site 111
Active Site 116
Active Site 155
Active Site 106
Active Site 111
Active Site 116

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here